« Back
Home /
Grp75/MOT/HSPA9 Rabbit mAb

Grp75/MOT/HSPA9 Rabbit mAb

Item no.	A11256-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Neuroscience Neural Mitochondrial Function Molecular Targets for Neuroscience Targets for Rodent Neurosciences Antibodies Immunohistochemistry Western Blot Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	EAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ
NCBI	HSPA9
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	CSA,MOT,MOT2,SAAN,CRP40,EVPLS,GRP75,PBP74,GRP-75,HSPA9B,SIDBA4,MTHSP75,HEL-S-124m,Grp75/MOT/HSPA9
Similar products	GRP75, PBP74, HSPA9B, CSA, MOT, MOT2, MTHSP75, GRP-75, HEL-S-124m, CRP40, EVPLS, SAAN, SIDBA4
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	74kDa
Background	This gene encodes a member of the heat shock protein 70 gene family. The encoded protein is primarily localized to the mitochondria but is also found in the endoplasmic reticulum, plasma membrane and cytoplasmic vesicles. This protein is a heat-shock cognate protein. This protein plays a role in cell proliferation, stress response and maintenance of the mitochondria. A pseudogene of this gene is found on chromosome 2.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 580-679 of human Grp75/MOT/HSPA9 (P38646).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	74kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Epigenetics nuclear signaling, RNA binding, Cancer, Tumor biomarkers, Signal transduction, Cell biology developmental biology, Apoptosis, Cell cycle, Endocrine metabolism, Mitochondrial metabolism, Mitochondrial markers.
Antigen Seq	EAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ
Manufacturer - Gene ID (Human)	3313
Expected Protein Size	74kDa
Gene Symbol	HSPA9

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A11256-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 10/2/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer