« Back
Home /
DAP Kinase 1 (DAPK1) Rabbit mAb

DAP Kinase 1 (DAPK1) Rabbit mAb

Item no.	A11459-20ul
Manufacturer	Abclonal
Amount	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Neuroscience Molecular Targets for Neuroscience Antibodies Western Blot Primary Antibodies By Organ Breast Cancer
Type	Antibody Monoclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	DFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFAARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIH
NCBI	DAPK1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	DAPK,ROCO3,DAP Kinase 1 (DAPK1)
Similar products	DAPK
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	160kDa
Background	Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consensus sites. It is a tumor suppressor candidate. Alternative splicing results in multiple transcript variants.
Manufacturer - Cross Reactivity	Human, Mouse
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-350 of human DAP Kinase 1 (DAPK1) (P53355).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	160kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Cancer, Tumor suppressors, Signal Transduction, Kinase, Serine threonine kinases, MAPK-Erk Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Autophagy, Death Receptor Signaling Pathway, Neuroscience, Calcium Signaling.
Antigen Seq	DFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFAARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIH
Manufacturer - Gene ID (Human)	1612
Expected Protein Size	160kDa
Gene Symbol	DAPK1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A11459-20ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ul

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer