« Back
Home /
LIF Rabbit pAb

LIF Rabbit pAb

Item no.	A1288-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Metabolism Diabetes Glucose Homeostasis Antibodies Obesity Immunohistochemistry Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
NCBI	LIF
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CDF,DIA,HILDA,MLPLI,LIF
Similar products	LIF, CDF, DIA, HILDA, MLPLI
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight	22kDa
Background	The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 23-202 of human LIF (NP_002300.1).
Recommended Dilution	WB, 1:500 - 1:2000; IHC-P, 1:50- 1:200
Protein Size	22kDa
Route	Synthetic peptide
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Cancer, Tumor suppressors, Cell Biology Developmental Biology, Cell Cycle, Cell differentiation, Growth factors, Immunology Inflammation, Cytokines, Cell Intrinsic Innate Immunity Signaling Pathway, Neuroscience.
Antigen Seq	SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Manufacturer - Gene ID (Human)	3976
Expected Protein Size	22kDa
Gene Symbol	LIF

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A1288-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 10/2/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer