Comparison

PLA2G6 Rabbit pAb European Partner

Item no. A14808-500uL
Manufacturer Abclonal
Amount 500 uL
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence GNTPLHLAMSKDNMEMVKALIVFGAEVDTPNDFGETPALIASKISKLITRKALLTLLKTVGADHHFPIIQGVSTEQGSAAATHPLFSLDRTQPPAISLNNL
NCBI Pla2g6
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias iPLA2,PNPLA9,iPLA2beta,iPLA(2)beta,PLA2G6
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Availability
Inquiry before order
Background
Enables calcium-independent phospholipase A2 activity; palmitoyl-CoA hydrolase activity; and serine hydrolase activity. Involved in positive regulation of insulin secretion involved in cellular response to glucose stimulus. Predicted to be located in centriolar satellite; cytosol; and extracellular space. Predicted to be active in mitochondrion. Is expressed in 1st branchial arch maxillary component; olfactory placode; otic pit; and trunk somite. Used to study neurodegeneration with brain iron accumulation 2a. Human ortholog(s) of this gene implicated in dystonia 12; neuroaxonal dystrophy; and neurodegenerative disease (multiple). Orthologous to human PLA2G6 (phospholipase A2 group VI).
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 350-450 of mouse PLA2G6 (NP_001185952.1).
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
83kDa/89kDa
Route
Synthetic Peptide
Manufacturer - Research Area
Signal Transduction

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close