« Back
Home /
TRK fused gene (TFG) Rabbit mAb

TRK fused gene (TFG) Rabbit mAb

Item no.	A1534-20ul
Manufacturer	Abclonal
Amount	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Antibodies By Cell Type Carcinoma Western Blot Primary Antibodies
Type	Antibody Primary
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	APAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR
NCBI	TFG
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TF6,HMSNP,SPG57,TRKT3,TRK fused gene (TFG)
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	43kDa
Background	There are several documented fusion oncoproteins encoded partially by this gene. This gene also participates in several oncogenic rearrangements resulting in anaplastic lymphoma and mixoid chondrosarcoma, and may play a role in the NF-kappaB pathway. Multiple transcript variants have been found for this gene.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 301-400 of human TRK fused gene (TFG) (Q92734).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	43kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Cancer, Signal Transduction, Kinase, Tyrosine kinases, Immunology Inflammation.
Antigen Seq	APAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR
Manufacturer - Gene ID (Human)	10342
Expected Protein Size	43kDa
Gene Symbol	TFG

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A1534-20ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ul

available

Delivery expected until 10/2/2025

Compare

Add to wishlist

Get an offer

Request delivery time