Comparison

Histone H3 Rabbit pAb European Partner

Item no. A15741-20uL
Manufacturer Abclonal
Amount 20 uL
Quantity options 100 uL 200 uL 20 uL 50 uL
Category
Type Antibody Polyclonal
Applications WB, IF, ICC
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
NCBI H3C4
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias H3/b,H3C1,H3C2,H3C3,H3C6,H3C7,H3C8,H3FB,H3C10,H3C11,H3C12,HIST1H3D
Available
Manufacturer - Category
Polyclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.
Manufacturer - Cross Reactivity
Human, Mouse, Rat, Monkey
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human HIST1H3D (NP_003520.1).
Recommended Dilution
WB, 1:500 - 1:2000|IF/ICC, 1:50 - 1:100
Protein Size
15kDa
Route
Recombinant Protein
Manufacturer - Research Area
Signal Transduction, MAPK-Erk Signaling Pathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close