« Back
Home /
MARK2 Rabbit pAb

MARK2 Rabbit pAb

Item no.	A16706-20ul
Manufacturer	Abclonal
Amount	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Neuroscience Molecular Targets for Neuroscience Antibodies By Cell Type Carcinoma Hematology Myeloma Western Blot Immunofluorescence Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	RYNEVMATYLLLGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAAGPAIPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPA
NCBI	MARK2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	EMK1, EMK-1, PAR-1, Par1b, Par-1b, MARK2
Similar products	PAR-1, MARK2, EMK1, Par1b, EMK-1, Par-1b
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background	This gene encodes a member of the Par-1 family of serine/threonine protein kinases. The protein is an important regulator of cell polarity in epithelial and neuronal cells, and also controls the stability of microtubules through phosphorylation and inactivation of several microtubule-associating proteins. The protein localizes to cell membranes. Multiple transcript variants encoding different isoforms have been found for this gene.
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 350-455 of human MARK2 (Q7KZI7).
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:50 - 1:100
Protein Size	88kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, RNA Binding, Signal Transduction, Kinase, Serine threonine kinases, Cell Biology Developmental Biology, Cytoskeleton, Microtubules, Wnt ��-Catenin Signaling Pathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A16706-20ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ul

available

Delivery expected until 9/11/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer