Comparison

FOXI1 Rabbit pAb European Partner

Item no. A16852-1000uL
Manufacturer Abclonal
Amount 1000 uL
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Purity Affinity purification
Sequence MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVS
NCBI FOXI1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias HFH3, FKH10, HFH-3, FKHL10, FREAC6, FREAC-6, FOXI1
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background
This gene belongs to the forkhead family of transcription factors, which is characterized by a distinct forkhead domain. This gene may play an important role in the development of the cochlea and vestibulum, as well as in embryogenesis. The encoded protein has been found to be required for the transcription of four subunits of a proton pump found in the inner ear, the kidney, and the epididymis. Mutations in this gene have been associated with deafness, autosomal recessive 4.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOXI1 (NP_036320.2).
Recommended Dilution
WB, 1:100 - 1:500
Protein Size
41kDa
Route
Synthetic Peptide
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Transcription Factors

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close