« Back
Home /
THBS1 Rabbit pAb

THBS1 Rabbit pAb

Item no.	A16985-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Neuroscience Molecular Targets for Neuroscience Antibodies Immunohistochemistry ELISA Primary Antibodies Immunostaining
Type	Antibody Polyclonal
Applications	ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Purity	Affinity purification
Sequence	TGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGS
NCBI	THBS1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TSP,THBS,TSP1,TSP-1,THBS-1,THBS1
Similar products	THBS1, TSP, TSP1, TSP-1, THBS, THBS-1
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	129kDa
Background	The protein encoded by this gene is a subunit of a disulfide-linked homotrimeric protein. This protein is an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. This protein can bind to fibrinogen, fibronectin, laminin, type V collagen and integrins alpha-V/beta-1. This protein has been shown to play roles in platelet aggregation, angiogenesis, and tumorigenesis.
Manufacturer - Cross Reactivity	Mouse
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human THBS1 (NP_003237.2).
Recommended Dilution	IHC-P, 1:50 - 1:200
Protein Size	129kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Cancer, Invasion and Metastasis, Cell Biology Developmental Biology, Cell Adhesion, Endocrine Metabolism, Neuroscience, Cell Type Marker, Stem Cells, Cardiovascular, Angiogenesis, Blood, Hypoxia, Astrocyte marker.
Antigen Seq	TGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGS
Manufacturer - Gene ID (Human)	7057
Expected Protein Size	129kDa
Gene Symbol	THBS1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A16985-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/18/2025

Compare

Add to wishlist

Get an offer

Request delivery time