« Back
Home /
DOCK1 Rabbit pAb

DOCK1 Rabbit pAb

Item no.	A17359-500uL
Manufacturer	Abclonal
Amount	500 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Purity	Affinity purification
Sequence	QTPPPVTPRAKLSFSMQSSLELNGMTGADVADVPPPLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPPLPSKTPPPPPPKTTRKQTSVDSGIVQ
NCBI	DOCK1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ced5,DOCK180,DOCK1
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Protein Weight	215kDa
Background	This gene encodes a member of the dedicator of cytokinesis protein family. Dedicator of cytokinesis proteins act as guanine nucleotide exchange factors for small Rho family G proteins. The encoded protein regulates the small GTPase Rac, thereby influencing several biological processes, including phagocytosis and cell migration. Overexpression of this gene has also been associated with certain cancers. Alternative splicing results in multiple transcript variants.
Manufacturer - Cross Reactivity	Human
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1766-1865 of human DOCK1 (NP_001371.1).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	215kDa
Route	Synthetic peptide
Manufacturer - Research Area	Signal Transduction, G protein signaling, Small G proteins, Cell Biology Developmental Biology, Apoptosis, Endocrine Metabolism.
Antigen Seq	QTPPPVTPRAKLSFSMQSSLELNGMTGADVADVPPPLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPPLPSKTPPPPPPKTTRKQTSVDSGIVQ
Manufacturer - Gene ID (Human)	1793
Expected Protein Size	215kDa
Gene Symbol	DOCK1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A17359-500uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 9/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer