« Back
Home /
SLC31A1 Rabbit pAb

SLC31A1 Rabbit pAb

Item no.	A17463-200uL
Manufacturer	Abclonal
Amount	200 uL
Quantity options	100 uL 200 uL 20 uL 50 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSG
NCBI	SLC31A1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CTR1, NSCT, COPT1, SLC31A1
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Availability	Inquiry before order
Background	The protein encoded by this gene is a high-affinity copper transporter found in the cell membrane. The encoded protein functions as a homotrimer to effect the uptake of dietary copper.
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SLC31A1 (NP_001850.1).
Recommended Dilution	IF/ICC, 1:50 - 1:200
Protein Size	21kDa
Route	Recombinant protein
Manufacturer - Research Area	Neuroscience

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A17463-200uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 uL

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer