« Back
Home /
RAB3GAP2 Rabbit pAb

RAB3GAP2 Rabbit pAb

Item no.	A17669-50ul
Manufacturer	Abclonal
Amount	50 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Neuroscience Protein Aggregation, Clearance & Misfolding Antibodies By Cell Type Carcinoma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Western Blot Primary Antibodies By Organ Heart & Blood Cancer
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MACSIVQFCYFQDLQAARDFLFPHLREEILSGALRRDPSKSTDWEDDGWGAWEENEPQEPEEEGNTCKTQKTSWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSGSLNVEEGECVTSALCIPLASQKRSSTGRPDWTCIVVGFTSGYVRFYTENGVLLLAQLLNEDPVLQLKCRTYEIPRHPG
NCBI	RAB3GAP2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	p150,SPG69,MARTS1,WARBM2,RAB3GAP150,RAB3-GAP150,RAB3GAP2
Similar products	p150, RAB3GAP2, RAB3-GAP150, RAB3GAP150, SPG69, WARBM2
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Protein Weight	156kDa
Background	The protein encoded by this gene belongs to the RAB3 protein family, members of which are involved in regulated exocytosis of neurotransmitters and hormones. This protein forms the Rab3 GTPase-activating complex with RAB3GAP1, where it constitutes the regulatory subunit, whereas the latter functions as the catalytic subunit. This gene has the highest level of expression in the brain, consistent with it having a key role in neurodevelopment. Mutations in this gene are associated with Martsolf syndrome.
Manufacturer - Cross Reactivity	Human, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human RAB3GAP2 (NP_036546.2).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	156kDa
Route	Recombinant protein
Manufacturer - Research Area	Signal Transduction, G protein signaling, Small G proteins, Cell Biology Developmental Biology, Neuroscience.
Antigen Seq	MACSIVQFCYFQDLQAARDFLFPHLREEILSGALRRDPSKSTDWEDDGWGAWEENEPQEPEEEGNTCKTQKTSWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSGSLNVEEGECVTSALCIPLASQKRSSTGRPDWTCIVVGFTSGYVRFYTENGVLLLAQLLNEDPVLQLKCRTYEIPRHPG
Manufacturer - Gene ID (Human)	25782
Expected Protein Size	156kDa
Gene Symbol	RAB3GAP2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A17669-50ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ul

available

Delivery expected until 10/9/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer