« Back
Home /
NANOS3 Rabbit pAb

NANOS3 Rabbit pAb

Item no.	A17925-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Purity	Affinity purification
Sequence	MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATRERAHTRRFCPLTGQGYTSVYSHTTRNSAGKKLVRPDKAKTQDTGHRRGGGGGAGFRGAGKSEPSPSCSPSMST
NCBI	NANOS3
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	NOS3, NANOS1L, ZC2HC12C, NANOS3
Similar products	NOS3, NANOS3, NANOS1L, ZC2HC12C
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Availability	Inquiry before order
Background	Predicted to enable mRNA binding activity. Involved in germ cell development; negative regulation of translation; and positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay. Located in nucleus and perinuclear region of cytoplasm.
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-192 of human NANOS3 (NP_001092092.1).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	19kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Cell Cycle, Cell differentiation, Stem Cells, Germline Stem Cells

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A17925-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 9/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer