Comparison

PPARα Rabbit pAb European Partner

Item no. A18252-50ul
Manufacturer Abclonal
Amount 50 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Purity Affinity purification
Sequence MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILS
NCBI PPARA
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias PPAR, NR1C1, hPPAR, PPARalpha, PPAR alpha, PPARA
Similar products PPARA, NR1C1, PPAR, PPAR alpha, PPARalpha, hPPAR
Available
Manufacturer - Category
Polyclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background
Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers; this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and animals that contain enzymes for respiration and for cholesterol and lipid metabolism. The action of peroxisome proliferators is thought to be mediated via specific receptors, called PPARs, which belong to the steroid hormone receptor superfamily. PPARs affect the expression of target genes involved in cell proliferation, cell differentiation and in immune and inflammation responses. Three closely related subtypes (alpha, beta/delta, and gamma) have been identified. This gene encodes the subtype PPAR-alpha, which is a nuclear transcription factor. Multiple alternatively spliced transcript variants have been described for this gene, although the full-length nature of only two has been determined.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human PPARα (NP_001001928.1).
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
52kDa
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Transcription Factors, Nuclear Receptor Signaling, Nuclear hormone receptors, Cancer, Signal Transduction, Endocrine Metabolism, Mitochondrial metabolism, Lipid Metabolism, Nucleotide metabolism, Cardiovascular, Hypoxia, Lipids, Fatty Acids

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close