« Back
Home /
HTR1A Rabbit pAb

HTR1A Rabbit pAb

Item no.	A18283-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Neuroscience Metabolism Diabetes Glucose Homeostasis Molecular Targets for Neuroscience Antibodies Obesity Western Blot Cardiovascular Research Heart Failure Myocardial Infarction Hypertension Primary Antibodies Arrhythmias
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Purity	Affinity purification
Sequence	RAARFRIRKTVKKVEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARE
NCBI	HTR1A
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	G-21, 5HT1a, PFMCD, 5-HT1A, 5-HT-1A, ADRBRL1, ADRB2RL1, HTR1A
Similar products	5-HT-1A, HTR1A, 5HT1a, ADRBRL1, ADRB2RL1, 5-HT1A, G-21, PFMCD
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Availability	Inquiry before order
Background	This gene encodes a G protein-coupled receptor for 5-hydroxytryptamine (serotonin), and belongs to the 5-hydroxytryptamine receptor subfamily. Serotonin has been implicated in a number of physiologic processes and pathologic conditions. Inactivation of this gene in mice results in behavior consistent with an increased anxiety and stress response. Mutation in the promoter of this gene has been associated with menstrual cycle-dependent periodic fevers.
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 220-340 of human HTR1A (NP_000515.2).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	46kDa
Route	Recombinant protein
Manufacturer - Research Area	Cancer, Signal Transduction, G protein signaling, G-Protein-Coupled ReceptorsGPCR, Endocrine Metabolism, Endocrine and metabolic diseases, Obesity, Neuroscience

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A18283-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 8/14/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer