« Back
Home /
SI Rabbit pAb

SI Rabbit pAb

Item no.	A18379-1000uL
Manufacturer	Abclonal
Amount	1000 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Purity	Affinity purification
Sequence	ADICGFFNNSEYHLCTRWMQLGAFYPYSRNHNIANTRRQDPASWNETFAEMSRNILNIRYTLLPYFYTQMHEIHANGGTVIRPLLHEFFDEKPTWDIFKQFLWGPAFMVTPVLEPYVQTVNAYVPNARWFDYHTGKDIGVRGQFQTFNASYDTINLHVRGGHILPCQEPAQNTFYSRQKHMKLIVAADDNQMAQGSLFWDDGESIDTYERDLYLSVQFNLNQTTLTSTILKRGYINKSETRLGSLHVWGKGTTPV
NCBI	SI
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	SI
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Availability	Inquiry before order
Background	This gene encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency.
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1528-1827 of human SI (NP_001032.2).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	209kDa
Route	Recombinant protein
Manufacturer - Research Area	Cancer, Endocrine Metabolism, Carbohydrate metabolism

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A18379-1000uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 uL

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer