« Back
Home /
LEMD2 Rabbit pAb

LEMD2 Rabbit pAb

Item no.	A18558-20ul
Manufacturer	Abclonal
Amount	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Neuroscience Neural Lineage Markers Antibodies By Cell Type Carcinoma Sarcoma Cell Biology Cytoskeleton Western Blot Primary Antibodies Intermediate filaments By Organ Breast Cancer
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Purity	Affinity purification
Sequence	PEVGRRLERWLSRLLLWASLGLLLVFLGILWVKMGKPSAPQEAEDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPENLKSKCI
NCBI	LEMD2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	LEM2,NET25,MARUPS,CTRCT42,dJ482C21.1,LEMD2
Similar products	LEMD2, NET25, dJ482C21.1, CTRCT42
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Protein Weight	57kDa
Background	This gene encodes a LEM domain-containing transmembrane protein of the inner nuclear membrane. The protein is involved in nuclear structure organization and plays a role in cell signaling and differentiation. Mutations in this gene result in Cataract 46, juvenile-onset. Multiple transcript variants have been found for this gene.
Manufacturer - Cross Reactivity	Mouse
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human LEMD2 (NP_851853.1).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	57kDa
Route	Synthetic peptide
Manufacturer - Research Area	Apoptosis, Cell Adhesion, Neuroscience.
Antigen Seq	PEVGRRLERWLSRLLLWASLGLLLVFLGILWVKMGKPSAPQEAEDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPENLKSKCI
Manufacturer - Gene ID (Human)	221496
Expected Protein Size	57kDa
Gene Symbol	LEMD2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A18558-20ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ul

available

Delivery expected until 10/9/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer