« Back
Home /
SMAD2/SMAD3 Rabbit pAb

SMAD2/SMAD3 Rabbit pAb

Item no.	A18674-20ul
Manufacturer	Abclonal
Amount	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Antibodies By Cell Type Glioma Western Blot Primary Antibodies By Organ Colorectal Cancer Neurodegeneration Markers
Type	Antibody Primary
Applications	WB, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	EYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSE
NCBI	SMAD2/SMAD3
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	HSPC193,HsT17436,JV15-2,LDS1C,LDS3,MADH3,SMAD2/SMAD3
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Protein Weight	48kDa/52kDa/25kDa/35kDa/43kDa
Background	The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-270 of human SMAD2/SMAD3SMAD3 (NP_005893.1).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	48kDa/52kDa/25kDa/35kDa/43kDa
Route	Synthetic peptide
Manufacturer - Research Area	Protein phosphorylation.
Antigen Seq	EYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSE
Manufacturer - Gene ID (Human)	4087/4088
Expected Protein Size	48kDa/52kDa/25kDa/35kDa/43kDa
Gene Symbol	SMAD2/SMAD3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A18674-20ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ul

available

Delivery expected until 10/9/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer