Comparison

NTRK1/NTRK2/NTRK3 Rabbit pAb European Partner

Item no. A18809-20ul
Manufacturer Abclonal
Amount 20 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Primary
Applications WB, IF, ICC, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Purity Affinity purification
Sequence LYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
NCBI NTRK1/NTRK2/NTRK3
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background
Neurotrophic tyrosine kinase (NTRK) is a family of receptor tyrosine kinase.The NTRK gene family contains three members, NTRK1, NTRK2 and NTRK3, which produce TRKA, TRKB and TRKC proteins, respectively.TRK kinases leads to cell differentiation and may play important roles in normal neural functions.Rearrangements in the NTRK genes can result in two genes fusing together and producing altered TRK proteins, which can lead to uncontrolled growth of cancer cells. Neurotrophic tyrosine receptor kinase (NTRK) gene fusions are an actionable biomarker for cancer therapy and can be found in over 25 different types of cancer.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 700-796 of human NTRK1/NTRK2/NTRK3 (NP_002520.2).
Recommended Dilution
WB, 1:100 - 1:500|IF/ICC, 1:50 - 1:200
Route
Synthetic peptide
Manufacturer - Research Area
Protein phosphorylation, Cancer, Signal Transduction, Kinase, Tyrosine kinases, Cell Biology Developmental Biology, Growth factors, Neuroscience.
Antigen Seq
LYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
Manufacturer - Gene ID (Human)
4914/4915/4916
Gene Symbol
NTRK1/NTRK2/NTRK3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ul
Available: In stock
available

Delivery expected until 12/18/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close