Item no. |
A19014-1000uL |
Manufacturer |
Abclonal
|
Amount |
1000 uL |
Quantity options |
1000 uL
100 ul
200 ul
20 ul
500 uL
50 ul
|
Category |
|
Type |
Antibody Monoclonal |
Applications |
WB, IF, ICC, ELISA, IHC-P |
Specific against |
Human (Homo sapiens) |
Isotype |
IgG |
Conjugate/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT |
NCBI |
PECAM1 |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
CD31, PECA1, GPIIA', PECAM-1, endoCAM, CD31/EndoCAM, CD31/PECAM1 |
Shipping condition |
Cool pack |
Available |
|
Manufacturer - Category |
Monoclonal Antibodies |
Shipping Temperature |
ice pack |
Storage Conditions |
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Background |
The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation. |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4). |
Recommended Dilution |
WB, 1:2000 -1:10000|IHC-P, 1:500 - 1:1000|IF/ICC, 1:100 - 1:500 |
Protein Size |
83kDa |
Route |
Recombinant protein |
Manufacturer - Research Area |
Cancer, Tumor immunology, Invasion and Metastasis, Signal Transduction, Cell Biology Developmental Biology, Cell Adhesion, Cytoskeleton, Immunology Inflammation, CDs, Stem Cells, Hematopoietic Progenitors, Mesenchymal Stem Cells, Cardiovascular, Angiogenesis, Blood |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.