Comparison

[KO Validated] GSK3α Rabbit mAb European Partner

Item no. A19060-20ul
Manufacturer Abclonal
Amount 20 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Monoclonal
Applications WB, IP, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKV
NCBI GSK3A
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias GSK3 alpha,GSK3A,3α
Similar products GSK3A, GSK3 alpha
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
51kDa
Background
This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, as well as regulates the production of beta-amyloid peptides associated with Alzheimer's disease.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GSK3α (P49840).
Recommended Dilution
WB, 1:500 - 1:1000|IP, 1:500 - 1:1000
Protein Size
51kDa
Route
Synthetic Peptide
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Translation Control, Regulation of eIF4 and p70 S6 Kinase, Protein phosphorylation, Signal Transduction, Kinase, Serine threonine kinases, PI3K-Akt Signaling Pathway, mTOR Signaling Pathway, ErbB-HER Signaling Pathway, MAPK-Erk Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Inhibition of Apoptosis, Cell Cycle, Cell Adhesion, Wnt ��-Catenin Signaling Pathway, ESC Pluripotency and Differentiation, Endocrine Metabolism, Insulin Receptor Signaling Pathway, Endocrine and metabolic diseases, Diabetes, Immunology Inflammation, B Cell Receptor Signaling Pathway, Neuroscience, Neurodegenerative Diseases, Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimer's Disease, Stem Cells, Cardiovascular, Heart, Hypertrophy.
Antigen Seq
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKV
Manufacturer - Gene ID (Human)
2931
Expected Protein Size
51kDa
Gene Symbol
GSK3A

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close