Comparison

NLK Rabbit mAb European Partner

Item no. A19270-200ul
Manufacturer Abclonal
Amount 200 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Monoclonal
Applications WB, ELISA, IHC-P
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence AVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINP
NCBI NLK
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias NLK, nemo like kinase, LAK1
Similar products NLK, nemo like kinase
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Background
Enables ubiquitin protein ligase binding activity. Involved in protein stabilization and transforming growth factor beta receptor signaling pathway. Predicted to be located in cytosol and nucleoplasm. Predicted to be active in cytoplasm and nucleus.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 400-500 of human NLK (NP_057315.3).
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200
Protein Size
58kDa
Route
Synthetic peptide
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Signal Transduction, Kinase, Serine threonine kinases, Cell Biology Developmental Biology, Cell Cycle, Wnt ��-Catenin Signaling Pathway, Stem Cells

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close