« Back
Home /
YY1 Rabbit mAb

YY1 Rabbit mAb

Item no.	A19569-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Antibodies By Cell Type Hematology Leukemia Western Blot Immunofluorescence Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, IF, IP, ICC, ELISA, CHIP
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	PGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH
NCBI	YY1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	DELTA,NF-E1,UCRBP,GADEVS,INO80S,YIN-YANG-1,YY1
Similar products	YY1, INO80S, NF-E1, DELTA, UCRBP, YIN-YANG-1
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	45kDa
Background	YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human YY1 (P25490).
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:50 - 1:200\|IP, 1:1000 - 1:5000\|ChIP, 1:1000 - 1:5000
Protein Size	45kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Transcription Factors, Endocrine Metabolism, Mitochondrial metabolism, Neuroscience.
Antigen Seq	PGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH
Manufacturer - Gene ID (Human)	7528
Expected Protein Size	45kDa
Gene Symbol	YY1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A19569-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 10/9/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer