« Back
Home /
Cullin 3 Rabbit mAb

Cullin 3 Rabbit mAb

Item no.	A19623-200ul
Manufacturer	Abclonal
Amount	200 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Neuroscience Aging & Neurological Disorders Neural Signaling Neural Development Antibodies Immunohistochemistry Western Blot Primary Antibodies By Organ Colorectal Cancer
Type	Antibody Monoclonal
Applications	WB, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	LHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
NCBI	CUL3
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	CUL-3,PHA2E,NEDAUS,Cullin 3
Similar products	CUL3, Cullin 3, PHA2E, CUL-3, cullin-3
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	89kDa
Background	This gene encodes a member of the cullin protein family. The encoded protein plays a critical role in the polyubiquitination and subsequent degradation of specific protein substrates as the core component and scaffold protein of an E3 ubiquitin ligase complex. Complexes including the encoded protein may also play a role in late endosome maturation. Mutations in this gene are a cause of type 2E pseudohypoaldosteronism. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 669-768 of human Cullin 3 (Q13618).
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200
Protein Size	89kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Cancer, Cell Biology Developmental Biology, Apoptosis, Cell Cycle, Cell cycle inhibitors, Ubiquitin, Ubiquitin-Proteasome Signaling Pathway.
Antigen Seq	LHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
Manufacturer - Gene ID (Human)	8452
Expected Protein Size	89kDa
Gene Symbol	CUL3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A19623-200ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ul

available

Delivery expected until 10/9/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer