Comparison

PPARγ Rabbit mAb European Partner

Item no. A19676-20ul
Manufacturer Abclonal
Amount 20 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Monoclonal
Applications WB, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence LSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH
NCBI PPARG
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias GLM1,CIMT1,NR1C3,PPARG1,PPARG2,PPARG5,PPARgamma,PPARγ
Similar products PPARgamma, PPARG, PPAR gamma, NR1C3, CIMT1, GLM1, PPARG1, PPARG2
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Background
This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described.
Manufacturer - Cross Reactivity
Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PPARγ (P37231).
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
58kDa
Route
Synthetic Peptide
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Transcription Factors, Nuclear Receptor Signaling, Signal Transduction, mTOR Signaling Pathway, MAPK-Erk Signaling Pathway, Cell Biology Developmental Biology, Endocrine Metabolism, Lipid Metabolism, Endocrine and metabolic diseases, Obesity, Neuroscience, Neurodegenerative Diseases, Stem Cells, Mesenchymal Stem Cells

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close