Comparison

Progesterone Receptor Rabbit mAb European Partner

Item no. A19697-100ul
Manufacturer Abclonal
Amount 100 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Monoclonal
Applications WB, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence AAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYD
NCBI PGR
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias PR,NR3C3,Progesterone Receptor
Similar products PR, PGR, NR3C3
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
99kd(CST:90, 118KD)
Background
This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. This gene uses two distinct promotors and translation start sites in the first exon to produce several transcript variants, both protein coding and non-protein coding. Two of the isoforms (A and B) are identical except for an additional 165 amino acids found in the N-terminus of isoform B and mediate their own response genes and physiologic effects with little overlap.
Manufacturer - Cross Reactivity
Human
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 260-330 of human Progesterone Receptor (NP_000917.3).
Recommended Dilution
WB, 1:500 - 1:2000|IHC-P, 1:50 - 1:200
Protein Size
99kd(CST:90, 118KD)
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Transcription Factors, Nuclear Receptor Signaling, Nuclear hormone receptors, Protein phosphorylation, Cancer, Tumor biomarkers, Signal Transduction, Endocrine Metabolism, Neuroscience.
Antigen Seq
AAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYD
Manufacturer - Gene ID (Human)
5241
Expected Protein Size
99kd(CST:90, 118KD)
Gene Symbol
PGR

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close