« Back
Home /
PRK2/PKN2 Rabbit mAb

PRK2/PKN2 Rabbit mAb

Item no.	A19746-200ul
Manufacturer	Abclonal
Amount	200 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Oncology Metabolism Diabetes Antibodies By Cell Type Carcinoma Hematology Leukemia Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKELKIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKL
NCBI	PKN2
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	PAK2,PRK2,STK7,Pak-2,PRKCL2,PRO2042,PRK2/PKN2
Similar products	PAK2, PRK2, STK7, PRKCL2, PRO2042, Pak-2
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	112kDa
Background	Enables RNA polymerase binding activity; histone deacetylase binding activity; and protein serine/threonine kinase activity. Involved in several processes, including apical junction assembly; positive regulation of cell cycle; and positive regulation of viral genome replication. Located in several cellular components, including cleavage furrow; cytoskeleton; and midbody.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRK2/PKN2 (Q16513).
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:50 - 1:200
Protein Size	112kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Epigenetics Nuclear Signaling, RNA Binding, Signal Transduction, Kinase.
Antigen Seq	MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKELKIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKL
Manufacturer - Gene ID (Human)	5586
Expected Protein Size	112kDa
Gene Symbol	PKN2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A19746-200ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ul

available

Delivery expected until 10/2/2025

Compare

Add to wishlist

Get an offer

Request delivery time