Item no. |
A19754-20ul |
Manufacturer |
Abclonal
|
Amount |
20 ul |
Quantity options |
1000 uL
100 ul
200 ul
20 ul
500 uL
50 ul
|
Category |
|
Type |
Antibody Monoclonal |
Applications |
WB, IF, ICC, ELISA, IHC-P |
Specific against |
Human (Homo sapiens) |
Host |
Rabbit |
Isotype |
IgG |
Conjugate/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
VDALVTLLVPLLVALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAASREVPRPLSTLPMFNVHTGERLPPRVDSAQVPLILDQH |
NCBI |
SGCA |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
ADL, DAG2, 50DAG, DMDA2, LGMD2D, LGMDR3, SCARMD1, adhalin, alpha Sarcoglycan (SGCA) |
Similar products |
ADL, DAG2, DMDA2, LGMD2D, SCARMD1, adhalin, 50DAG |
Shipping condition |
Cool pack |
Available |
|
Manufacturer - Category |
Monoclonal Antibodies |
Shipping Temperature |
ice pack |
Storage Conditions |
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Background |
This gene encodes a component of the dystrophin-glycoprotein complex (DGC), which is critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Its expression is thought to be restricted to striated muscle. Mutations in this gene result in type 2D autosomal recessive limb-girdle muscular dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene. |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 288-387 of human alpha Sarcoglycan (SGCA) (SGCA) (Q16586). |
Recommended Dilution |
WB, 1:100 - 1:500|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200 |
Protein Size |
43kDa |
Route |
Synthetic Peptide |
Manufacturer - Research Area |
Signal Transduction, Cell Biology Developmental Biology, Cytoskeleton, Extracellular Matrix |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.