« Back
Home /
STING Rabbit pAb

STING Rabbit pAb

Item no.	A20175-1000uL
Manufacturer	Abclonal
Amount	1000 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA, IHC-P
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	SREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKP
NCBI	Sting1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ERIS, MPYS, Mita, STING, Tmem173, STING-beta, 2610307O08Rik
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background	Enables 2', 3'-cyclic GMP-AMP binding activity; cyclic-di-GMP binding activity; and ubiquitin protein ligase binding activity. Involved in several processes, including defense response to other organism; macroautophagy; and positive regulation of interferon-beta production. Acts upstream of or within cellular response to interferon-beta; positive regulation of transcription by RNA polymerase II; and regulation of inflammatory response. Located in several cellular components, including autophagosome; perinuclear region of cytoplasm; and peroxisome. Is expressed in ductus deferens; epididymis; ileum; and prostate gland. Human ortholog(s) of this gene implicated in STING-associated vasculopathy with onset in infancy. Orthologous to human STING1 (stimulator of interferon response cGAMP interactor 1).
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 280-371 of mouse STING. (NP_938023.1).
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200
Protein Size	43kDa
Route	Recombinant protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A20175-1000uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 uL

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer