« Back
Home /
Caspase-1 Rabbit pAb

Caspase-1 Rabbit pAb

Item no.	A20470-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 uL 500 uL 50 ul
Category	Neuroscience Neural Signaling Antibodies Cell Biology Cell Status Apoptosis Immunohistochemistry Immunoprecipitation Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Immunostaining Immunochemistry
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	KVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQEGICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRD
NCBI	Casp1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ICE,Il1bc,CASP1
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight	46kDa
Background	Enables cysteine-type endopeptidase activity. Involved in several processes, including positive regulation of I-kappaB kinase/NF-kappaB signaling; positive regulation of interleukin-1 beta production; and protein autoprocessing. Acts upstream of or within several processes, including membrane hyperpolarization; mitochondrial depolarization; and positive regulation of interleukin-1 alpha production. Located in extracellular region. Part of IPAF inflammasome complex. Is expressed in knee joint and metanephros. Orthologous to human CASP1 (caspase 1).
Manufacturer - Cross Reactivity	Mouse
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of mouse CASP1 (NP_033937.2).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	46kDa
Route	Synthetic peptide
Antigen Seq	KVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQEGICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRD
Manufacturer - Gene ID (Human)	834
Expected Protein Size	46kDa
Gene Symbol	Casp1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A20470-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/18/2025

Compare

Add to wishlist

Get an offer

Request delivery time