« Back
Home /
S100A8 Rabbit pAb

S100A8 Rabbit pAb

Item no.	A20474-100ul
Manufacturer	Abclonal
Amount	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 uL 500 uL 50 ul
Category	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Molecular Targets for Neuroscience Targets for Rodent Neurosciences Antibodies By Cell Type Melanoma Immunohistochemistry Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Immunostaining Cytoskeleton Markers Immunochemistry
Type	Antibody Polyclonal
Applications	WB, ELISA, IHC-P
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
NCBI	S100a8
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	p8,B8Ag,CFAg,Caga,MRP8,CP-10,60B8Ag,S100A8
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight	10kDa
Background	Predicted to enable calcium ion binding activity and calcium-dependent protein binding activity. Acts upstream of or within astrocyte development and positive regulation of peptide secretion. Predicted to be located in cytosol and intermediate filament cytoskeleton. Predicted to be active in extracellular space. Is expressed in several structures, including bone marrow; extraembryonic component; female reproductive system; and liver. Human ortholog(s) of this gene implicated in myocarditis. Orthologous to human S100A8 (S100 calcium binding protein A8).
Manufacturer - Cross Reactivity	Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-89 of mouse S100A8 (NP_038678.1).
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200
Protein Size	10kDa
Route	Recombinant protein
Antigen Seq	MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
Manufacturer - Gene ID (Human)	6279
Expected Protein Size	10kDa
Gene Symbol	S100a8

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A20474-100ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/18/2025

Compare

Add to wishlist

Get an offer

Request delivery time