Comparison

IL1β Rabbit pAb European Partner

Item no. A20529-500uL
Manufacturer Abclonal
Amount 500 uL
Quantity options 1000 uL 100 ul 200 ul 20 uL 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Rat (Rattus norvegicus)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
NCBI Il1b
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias IL-1F2
Available
Manufacturer - Category
Polyclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background
Enables cytokine activity. Involved in several processes, including positive regulation of intracellular signal transduction; regulation of gene expression; and regulation of neurogenesis. Located in extracellular space. Used to study several diseases, including artery disease (multiple); brain disease (multiple); glomerulonephritis (multiple); interstitial lung disease (multiple); and kidney failure (multiple). Biomarker of several diseases, including artery disease (multiple); auditory system disease (multiple); brain disease (multiple); kidney failure (multiple); and lung disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including autoimmune disease (multiple); blood platelet disease (multiple); eye disease (multiple); gastrointestinal system cancer (multiple); and lung disease (multiple). Orthologous to human IL1B (interleukin 1 beta).
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 117-268 of rat IL1β (NP_113700.2).
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
31kDa
Route
Recombinant protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 uL
Available: In stock
available

Delivery expected until 8/28/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close