Comparison

HCoV-OC43 Nucleoprotein Rabbit pAb European Partner

Item no. A20610-500uL
Manufacturer Abclonal
Amount 500 uL
Quantity options 1000 uL 100 ul 200 ul 20 uL 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against other
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence YWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRS
NCBI HCoV-OC43 Nucleoprotein
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias HCoV-OC43 Nucleoprotein
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of coronavirus Nucleoprotein (YP_009555245.1).
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
49kDa
Route
Synthetic peptide

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close