Comparison

HCoV-NL63 Spike S2 Rabbit pAb European Partner

Item no. A20611-20uL
Manufacturer Abclonal
Amount 20 uL
Quantity options 1000 uL 100 ul 200 ul 20 uL 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against other
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence VNISRVELHTVIPDYVDVNKTLQEFAQNLPKYVKPNFDLTPFNLTYLNLSSELKQLEAKTASLFQTTVELQGLIDQINSTYVDLKLLNRFENYIKWPWWVW
NCBI HCoV-NL63 Spike S2
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias HCoV-NL63 Spike S2
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background
S1 region attaches the virion to the cell membrane by interacting with host ACE2, initiating the infection. Binding to the receptor probably induces conformational changes in the S glycoprotein unmasking the fusion peptide and activating membranes fusion. S2 region belongs to the class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of coronavirus Spike S2 (YP_003767.1).
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
150kDa
Route
Synthetic peptide

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close