Comparison

UGT2B17 Rabbit pAb European Partner

Item no. A20683-200ul
Manufacturer Abclonal
Amount 200 ul
Quantity options 1000 uL 100 ul 200 ul 20 uL 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications IF, ICC, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence GHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMS
NCBI UGT2B17
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias BMND12, UDPGT2B17, UGT2B17
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background
This gene encodes a member of the uridine diphosphoglucuronosyltransferase protein family. The encoded enzyme catalyzes the transfer of glucuronic acid from uridine diphosphoglucuronic acid to a diverse array of substrates including steroid hormones and lipid-soluble drugs. This process, known as glucuronidation, is an intermediate step in the metabolism of steroids. Copy number variation in this gene is associated with susceptibility to osteoporosis.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 50-200 of human UGT2B17 (NP_001068.1).
Recommended Dilution
IF/ICC, 1:50 - 1:200
Protein Size
61kDa
Route
Recombinant Protein
Manufacturer - Research Area
Cancer, Signal Transduction, Cell Biology Developmental Biology, Cytoskeleton, Extracellular Matrix, Bone, Growth factors, Endocrine Metabolism, Drug metabolism

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close