« Back
Home /
SDG724 Rabbit pAb

SDG724 Rabbit pAb

Item no.	A20704-500uL
Manufacturer	Abclonal
Amount	500 uL
Quantity options	1000 uL 100 ul 200 ul 20 uL 500 uL 50 ul
Category	Antibodies Western Blot ELISA Primary Antibodies Immunostaining
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Oryza sativa
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
NCBI	LOC4346677
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	SDG724,lvp1,OsSET34
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight	45kDa
Background	The Histone Methyltransferase SDG724 Mediates H3K36me2/3 Deposition at MADS50 and RFT1 and Promotes Flowering in Rice.
Manufacturer - Cross Reactivity	Oryza sativa
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of Oryza sativa SDG724. (XP_015651319.1).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	45kDa
Route	Recombinant protein
Antigen Seq	MIGRYGHPPNPLLLLRPHLASFLRRLPPLRHCSLAYGLELVADPRHRRDLCLPPMPRPAKIRKKHENVFDQLIKAIKAPVDFDLPPVLKEWKSNYYVPIKRNAYITRKRVEDDGIFCSCTPSGSSATCDKDCQCGMLFSCCSSTCKCENKCANKPFQHRTLRK
Expected Protein Size	45kDa
Gene Symbol	LOC4346677

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A20704-500uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 11/13/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer