« Back
Home /
TPL Rabbit pAb

TPL Rabbit pAb

Item no.	A21285-1000uL
Manufacturer	Abclonal
Amount	1000 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Thale cress (Arabidopsis thaliana)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	VDHSCGPPNGARAPSPVNNPLLGGIPKAGGFPPLGAHGPFQPTASPVPTPLAGWMSSPSSVPHPAVSAGAIALGGPSIPAALKHPRTPPTNASLDYPSADS
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	F7H2.9, F7H2_9, TOPLESS, WSIP1, WUS-INTERACTING PROTEIN 1, TPL
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Availability	Inquiry before order
Background	Encodes a protein with several WD40 repeats at the C-terminus and predicted protein-protein interaction domains at the N-terminus. Together with the TOPLESS-RELATED PROTEINS (TPRs), it is thought to be involved in transcriptional repression of root-promoting genes in the top half of the embryo during the transition stage of embryogenesis. It can also interact with IAA12 through the EAR domain of IAA12 and the CTLH domain of TPL. The ability of IAA12 to repress transcription is diminished in a tpl-1 mutant background.
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of arabidopsis thaliana TPL (NP_849672.1).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	124kDa
Route	Synthetic peptide

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A21285-1000uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 uL

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer