« Back
Home /
[KO Validated] YAP1 Rabbit pAb

[KO Validated] YAP1 Rabbit pAb

Item no.	A21732-100uL
Manufacturer	Abclonal
Amount	100 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSV
NCBI	YAP1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	YAP, YKI, COB1, YAP2, YAP-1, YAP65, P1
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background	This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1).
Recommended Dilution	WB, 1:100 - 1:500\|IHC-P, 1:50 - 1:200
Protein Size	54kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Transcription Factors, Protein phosphorylation, Cancer, Signal Transduction, Kinase, Tyrosine kinases, Cell Biology Developmental Biology

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A21732-100uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 uL

available

Delivery expected until 9/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time