« Back
Home /
ABflo® 488 Rabbit anti-Human CD55 mAb

ABflo® 488 Rabbit anti-Human CD55 mAb

Item no.	A21942-500T
Manufacturer	Abclonal
Amount	500 T
Quantity options	100 T 100 ug 100 ul 200 T 20 ul 25 ug 500 T 50 ug
Category	Antibodies Flow Cytometry Primary Antibodies
Type	Antibody Monoclonal
Applications	FC
Specific against	Human (Homo sapiens)
Isotype	IgG
Purity	Affinity purification
Sequence	DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLT
NCBI	CD55
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	CR,TC,DAF,CROM,CHAPLE
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Manufacturer - Conjugate / Tag	ABflo® 488. Ex:491nm. Em:516nm.
Shipping Temperature	ice pack
Storage Conditions	Store at 2-8°C. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Protein Weight	41kDa
Background	This gene encodes a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host cells. Antigens present on this protein constitute the Cromer blood group system (CROM). Alternative splicing results in multiple transcript variants. The predominant transcript variant encodes a membrane-bound protein, but alternatively spliced transcripts may produce soluble proteins.
Manufacturer - Cross Reactivity	Human
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 35-353 of human CD55 (NP_000565.1).
Recommended Dilution	FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size	41kDa
Route	Recombinant protein
Manufacturer - Research Area	Immunology Inflammation, CDs.
Antigen Seq	DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTS
Manufacturer - Gene ID (Human)	1604
Expected Protein Size	41kDa
Gene Symbol	CD55

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A21942-500T-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 T

available

Delivery expected until 11/13/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer