Comparison

PDK1/PDHK1 Rabbit mAb European Partner

Item no. A22383-20uL
Manufacturer Abclonal
Amount 20 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category
Type Antibody Monoclonal
Applications WB, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence STAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
NCBI PDK1
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias PDK1, pyruvate dehydrogenase kinase 1, PDK1/PDHK1
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Availability
Inquiry before order
Background
Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. Multiple alternatively spliced transcript variants have been found for this gene.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 337-436 of human PDK1/PDHK1 (NP_002601.1).
Recommended Dilution
WB, 1:2000 - 1:20000
Protein Size
49kDa
Route
Synthetic peptide
Manufacturer - Research Area
Cancer, Signal Transduction, PI3K-Akt Signaling Pathway, Endocrine Metabolism, Carbohydrate metabolism, Warburg Effect, Immunology Inflammation, T Cell Receptor Signaling Pathway, NF-kB Signaling Pathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close