« Back
Home /
SMURF2 Rabbit mAb

SMURF2 Rabbit mAb

Item no.	A2278-20ul
Manufacturer	Abclonal
Amount	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Neuroscience Aging & Neurological Disorders Antibodies Cell Biology Cell Status Immunohistochemistry Immunoprecipitation Western Blot ELISA Immunofluorescence Immunocytochemistry Autophagy Senescence Primary Antibodies Immunostaining Immunochemistry
Type	Antibody Primary
Applications	WB, IF, IP, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	PLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSN
NCBI	SMURF2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	SMURF2,E3 ubiquitin-protein ligase SMURF2
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	86kDa
Background	Enables SMAD binding activity; identical protein binding activity; and ubiquitin-protein transferase activity. Involved in negative regulation of transforming growth factor beta receptor signaling pathway; positive regulation of trophoblast cell migration; and ubiquitin-dependent SMAD protein catabolic process. Located in nuclear speck. Part of ubiquitin ligase complex.
Manufacturer - Cross Reactivity	Human, Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human SMURF2 (Q9HAU4).
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200\|IP, 1:500 - 1:1000
Protein Size	86kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Signal Transduction, Cell Biology Developmental Biology, Ubiquitin, Ubiquitin-Proteasome Signaling Pathway, TGF-b-Smad Signaling Pathway, Endocrine Metabolism, Mitochondrial metabolism, Immunology Inflammation, Stem Cells.
Antigen Seq	PLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSN
Manufacturer - Gene ID (Human)	64750
Expected Protein Size	86kDa
Gene Symbol	SMURF2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A2278-20ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ul

available

Delivery expected until 12/18/2025

Compare

Add to wishlist

Get an offer

Request delivery time