Comparison

XCP1 Rabbit pAb European Partner

Item no. A22853-20uL
Manufacturer Abclonal
Amount 20 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against other
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
NCBI 100283433
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias IDP105,GRMZM2G066326,XCP1,Cysteine protease5
Shipping Condition Cool pack
Available
Specificity Maize
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight
71kDa
Availability
Inquiry before order
Background
XCP1 is a xylem-specific papain-like cysteine peptidase in Arabidopsis. Results from confocal microscopy and biochemical subcellular fractionation indicated that XCP1 was localized in the vacuole. Ectopic expression of XCP1 resulted in a reduction in plant size in some lines and early leaf senescence, as indicated by early loss of leaf chlorophyll. Reduced plant size was correlated with higher levels of XCP1, as shown by immunoblot and peptidase activity gel analyses. The XCP1 prodomain exhibits exceptionally high similarity (greater than 80%) to the prodomains of papain and other papain-like enzymes isolated from papaya (Carica papaya) laticifers when compared with all other reported papain-like enzymes. The XCP1 and papain to perform common functions as catalysts of autolytic processing following cell death due to programmed suicide or to wounding is discussed.
Manufacturer - Cross Reactivity
Maize
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 157-377 of maize XCP1(NP_001149806.1).
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
71kDa
Route
Recombinant protein
Manufacturer - Research Area
Arabidopsis enzymology, Arabidopsis genetics.
Antigen Seq
EVPASVDWRKKGAVTEVKNQGQCGSCWAFSTVAAVEGINQIVTGNLTSLSEQQLVDCSTDGNNGCSGGVMDNAFSFIATGAGLRSEEAYPYLMEEGDCDDRARDGEVLVTISGYEDVPANDEQALVKALAHQPVSVAIEASGRHFQFYSGGVFDGPCGSELDHGVAAVGYGSSKGQDYIIVKNSWGTHWGEKGYIRMKRGTGKPEGLCGINKMASYPTKDH
Expected Protein Size
71kDa
Gene Symbol
100283433

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close