Comparison

[KO Validated] KRAS Rabbit mAb European Partner

Item no. A23382-100uL
Manufacturer Abclonal
Amount 100 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category
Type Antibody Monoclonal
Applications WB, ELISA, IHC-P
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCII
NCBI KRAS
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias NS, NS3, OES, CFC2, RALD, K-Ras, KRAS1, KRAS2, RASK2, KI-RAS, C-K-RAS, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, K-Ras 2, 'C-K-RAS, c-Ki-ras, c-Ki-ras2, AS
Shipping condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Background
This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-188 of human KRAS (NP_203524.1).
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200
Protein Size
22kDa
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Cancer, Signal Transduction, G protein signaling, Small G proteins, G-Protein-Coupled Receptors Signaling to MAPK Erk, Kinase, ErbB-HER Signaling Pathway, MAPK-Erk Signaling Pathway, MAPK-JNK Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Inhibition of Apoptosis, Cytoskeleton, Actins, TGF-b-Smad Signaling Pathway, ESC Pluripotency and Differentiation, Endocrine Metabolism, Insulin Receptor Signaling Pathway, Warburg Effect, Immunology Inflammation, B Cell Receptor Signaling Pathway, T Cell Receptor Signaling Pathway, Jak-Stat-IL-6 Receptor Signaling Pathway, NF-kB Signaling Pathway, Cardiovascular, Angiogenesis

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 uL
Available: In stock
available

Delivery expected until 5/22/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close