Comparison

ABflo® 488 Rabbit anti-Human CD16b mAb European Partner

Item no. A23401-200T
Manufacturer Abclonal
Amount 200 T
Quantity options 100 T 100 ul 200 T 20 ul 500 T
Category
Type Antibody Monoclonal
Applications FC
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag ABflo® 488. Ex:491nm. Em:516nm.
Purity Affinity purification
Sequence TEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQ
NCBI FCGR3B
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias CD16, CD16-I, CD16b, FCG3, FCGR3, FCGR3B, FCR-10, FCRIII, FCRIIIb
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at 2-8°C. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Background
This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other responses, including antibody dependent cellular mediated cytotoxicity and antibody dependent enhancement of virus infections. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene are associated with immunodeficiency 20, and have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-208 of human CD16b (NP_000561.3).
Recommended Dilution
FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size
26KDa
Route
Recombinant protein
Manufacturer - Research Area
Immunology, Immunoglobulins, Receptors

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 T
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close