« Back
Home /
ABflo® 488 Rabbit anti-Human CD28 mAb

ABflo® 488 Rabbit anti-Human CD28 mAb

Item no.	A23405-100T
Manufacturer	Abclonal
Amount	100 T
Quantity options	100 T 100 ul 200 T 20 ul 500 T
Category	Antibodies Flow Cytometry Primary Antibodies
Type	Antibody Monoclonal
Applications	FC
Specific against	Human (Homo sapiens)
Isotype	IgG
Purity	Affinity purification
Sequence	MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
NCBI	CD28
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	Tp44
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Manufacturer - Conjugate / Tag	ABflo® 488. Ex:491nm. Em:516nm.
Shipping Temperature	ice pack
Storage Conditions	Store at 2-8°C. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Protein Weight	25kDa
Background	The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Cross Reactivity	Human
Immunogen	Recombinant protein of human CD28 Full length(P10747).
Recommended Dilution	FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size	25kDa
Route	Recombinant protein
Manufacturer - Research Area	Signal Transduction, Cell Biology Developmental Biology, Apoptosis, Immunology Inflammation, CDs, T Cell Receptor Signaling Pathway, Stem Cells, Hematopoietic Progenitors.
Antigen Seq	MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Manufacturer - Gene ID (Human)	940
Expected Protein Size	25kDa
Gene Symbol	CD28

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A23405-100T-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 T

available

Delivery expected until 11/13/2025

Compare

Add to wishlist

Get an offer

Request delivery time