Comparison

Glypican 3 (GPC3) Rabbit mAb European Partner

Item no. A23410-100uL
Manufacturer Abclonal
Amount 100 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category
Type Antibody Monoclonal
Applications WB, FC, IF, ICC, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
NCBI GPC3
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias SGB,DGSX,MXR7,SDYS,SGBS,OCI-5,SGBS1,GTR2-2,Glypican 3 (GPC3)
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
66kDa
Background
Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The protein encoded by this gene can bind to and inhibit the dipeptidyl peptidase activity of CD26, and it can induce apoptosis in certain cell types. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome, also known as Simpson dysmorphia syndrome. Alternative splicing results in multiple transcript variants.
Manufacturer - Cross Reactivity
Human
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 481-580 of human Glypican 3 (GPC3) (NP_004475.1).
Recommended Dilution
WB, 1:1000 - 1:5000|IF/ICC, 1:100 - 1:500
Protein Size
66kDa
Route
Synthetic peptide
Manufacturer - Research Area
Cancer, Tumor biomarkers, Signal Transduction, Cell Biology Developmental Biology, Cytoskeleton, Stem Cells.
Antigen Seq
GRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFLVH
Manufacturer - Gene ID (Human)
2719
Expected Protein Size
66kDa
Gene Symbol
GPC3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 uL
Available: In stock
available

Delivery expected until 12/18/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close