« Back
Home /
CD8A Rabbit mAb

CD8A Rabbit mAb

Item no.	A23953-20uL
Manufacturer	Abclonal
Amount	20 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category	Oncology Antibodies By Cell Type Hematology Leukemia Flow Cytometry Immunohistochemistry Western Blot ELISA Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Applications	WB, FC, ELISA
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY
NCBI	Cd8a
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	Eukaryota,Metazoa,Chordata,Craniata,Vertebrata,Euteleostomi,Mammalia,Eutheria,Euarchontoglires,Glires,Rodentia,Myomorpha,Muroidea,Muridae,Murinae,Mus,CD8A
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	27kDa
Background	Enables identical protein binding activity. Acts upstream of or within several processes, including cytotoxic T cell differentiation; defense response to virus; and positive regulation of calcium-mediated signaling. Located in external side of plasma membrane. Is expressed in several structures, including endocrine gland; exocrine gland; genitourinary system; gut; and hemolymphoid system gland. Orthologous to human CD8A (CD8a molecule).
Manufacturer - Cross Reactivity	Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 28-196 of mouse CD8A(NP_001074579.1)
Recommended Dilution	WB, 1:500 - 1:1000\|FC, 1:100 - 1:500
Protein Size	27kDa
Route	Recombinant protein
Manufacturer - Research Area	Immunology, Adaptive Immunity, T Cells, Cytotoxic Cells.
Antigen Seq	KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY
Manufacturer - Gene ID (Human)	925
Expected Protein Size	27kDa
Gene Symbol	Cd8a

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A23953-20uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 uL

available

Delivery expected until 11/27/2025

Compare

Add to wishlist

Get an offer

Request delivery time