Comparison

NANOG Rabbit mAb European Partner

Item no. A23991-20uL
Manufacturer Abclonal
Amount 20 uL
Quantity options 100 uL 200 uL 20 uL 50 uL
Category
Type Antibody Monoclonal
Applications WB, ELISA, CHIP
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence LKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI
NCBI NANOG
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias ENK,Stm1,ecat4,2410002E02Rik,NANOG
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Background
The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Several transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Cross Reactivity
Human, Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 160-305 of mouse NANOG(NP_082292.1).
Recommended Dilution
WB, 1:500 - 1:1000|ChIP, 1:50 - 1:200
Protein Size
34kDa
Route
Recombinant protein
Manufacturer - Research Area
Molecular functioni chromatin binding, MGI cis-regulatory region sequence-specific DNA binding, RNA polymerase II-specific, DNA-binding transcription factor activity, DNA-binding transcription repressor activity, IntAct RNA polymerase II cis-regulatory region sequence-specific DNA binding

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close