« Back
Home /
PKC mu Rabbit mAb

PKC mu Rabbit mAb

Item no.	A2417-200ul
Manufacturer	Abclonal
Amount	200 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Neuroscience Neural Signaling Antibodies Western Blot Primary Antibodies
Type	Antibody Primary
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	RRRRLSNVSLTGVSTIRTSSAELSTSAPDEPLLQKSPSESFIGREKRSNSQSYIGRPIHLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQ
NCBI	PRKD1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	PKD, PKCM, CHDED, PRKCM, PKC-MU, PKC mu
Shipping Condition	Cool pack
Available
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Background	The protein encoded by this gene is a serine/threonine protein kinase involved in many cellular processes, including Golgi body membrane integrity and transport, cell migration and differentiation, MAPK8/JNK1 and Ras pathway signaling, MAPK1/3 (ERK1/2) pathway signaling, cell survival, and regulation of cell shape and adhesion.
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PKC mu (Q15139).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	102kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Protein phosphorylation, Cancer, Signal Transduction, G protein signaling, G-Protein-Coupled Receptors Signaling to MAPK Erk, Kinase, Serine threonine kinases, ErbB-HER Signaling Pathway, MAPK-Erk Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Mitochondrial Control of Apoptosis, Inhibition of Apoptosis, Autophagy, Cytoskeleton, Actins, Endocrine Metabolism, Lipid Metabolism, Immunology Inflammation, B Cell Receptor Signaling Pathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A2417-200ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ul

available

Delivery expected until 8/28/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer