« Back
Home /
CK14 Rabbit pAb

CK14 Rabbit pAb

Item no.	A24481-50uL
Manufacturer	Abclonal
Amount	50 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	QIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
NCBI	KRT14
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	KRT14,CK14,EBS3,EBS4,K14,NFJ,keratin 14
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight	51kDa
Background	This gene encodes a member of the keratin family, the most diverse group of intermediate filaments. This gene product, a type I keratin, is usually found as a heterotetramer with two keratin 5 molecules, a type II keratin. Together they form the cytoskeleton of epithelial cells. Mutations in the genes for these keratins are associated with epidermolysis bullosa simplex. At least one pseudogene has been identified at 17p12-p11.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 372-472 of human CK14 (NP_000517.3).
Recommended Dilution	WB, 1:1000 - 1:5000
Protein Size	51kDa
Route	Synthetic peptide
Manufacturer - Research Area	Signal Transduction, Cell Biology & Developmental Biology, Cytoskeleton, Intermediate Filaments, Extracellular Matrix, Cytokeratin, Keratin.
Antigen Seq	QIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
Expected Protein Size	51kDa
Gene Symbol	KRT14

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A24481-50uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 uL

available

Delivery expected until 10/16/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer